PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 251aa    MW: 28429.3 Da    PI: 7.46
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056265genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY70.62.2e-22128184258
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                           +Dg nWrKYGqK + g+++pr Y++C  ++C ++k v+r +++p ++e+tY ++H +
  PGSC0003DMP400056265 128 EDGLNWRKYGQKLILGAKYPREYFQCVCRHCDATKMVQRIQTEPLTFEVTYGESHSC 184
                           7******************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-22119186IPR003657WRKY domain
PROSITE profilePS5081117.832122183IPR003657WRKY domain
SuperFamilySSF1182904.45E-21124186IPR003657WRKY domain
SMARTSM007743.5E-22127186IPR003657WRKY domain
PfamPF031062.3E-20128184IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006032Biological Processchitin catabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004568Molecular Functionchitinase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGENNFWERE VVITELTKGK ELMLQLQKHF DPMKQDVYRY LAAEILSSYD KAMSLLNGTA  60
LSGMMSKSKE IINPSPSSST ASQLESHQLL ADSSTKSCDR PSKSRKRKML APRTEYVEAR  120
HGEEVPPEDG LNWRKYGQKL ILGAKYPREY FQCVCRHCDA TKMVQRIQTE PLTFEVTYGE  180
SHSCGQENKN RNEELLVAVG TQVGRAAGKL SECYIPEMVT PNNSKTKYPS DITYDTILQL  240
FSDQPSYIHL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103108SRKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-148HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010321619.11e-140PREDICTED: probable WRKY transcription factor 41
TrEMBLM1D7L10.0M1D7L1_SOLTU; Uncharacterized protein
STRINGSolyc05g050330.2.11e-153(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11070.12e-27WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]